PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013625134.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 246aa    MW: 28543.9 Da    PI: 5.4217
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013625134.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+++++++G  +W++ +++ g+ R++k+c++rw +yl
   XP_013625134.1 14 RGPWTPEEDQILINYINLYGHSNWRALPKHAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding48.91.5e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+++++ ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
   XP_013625134.1  67 RGNFTPQDEQTIINLHEVLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.265961IPR017930Myb domain
SuperFamilySSF466891.19E-3010108IPR009057Homeodomain-like
SMARTSM007172.2E-151363IPR001005SANT/Myb domain
PfamPF002496.2E-171461IPR001005SANT/Myb domain
CDDcd001671.71E-111661No hitNo description
PROSITE profilePS5129423.87262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.6E-2665117IPR009057Homeodomain-like
SMARTSM007172.5E-1366114IPR001005SANT/Myb domain
PfamPF002493.3E-1467112IPR001005SANT/Myb domain
CDDcd001677.93E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGRAPCCEKM GVKRGPWTPE EDQILINYIN LYGHSNWRAL PKHAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TPQDEQTIIN LHEVLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLNKDR  120
NNGGVTNELN GTNETAHEDK ESVIVDTTPT QQFTTLEILN NNKADEMMSY EDISALVDDS  180
FWSDVVSVDN KNSKEKMVED WEGMLNSNSK IYSYNNSKLY NDDLEFWFEV FNSSRRIEEL  240
SDIPEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28141177109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894330.0AC189433.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB068H20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625134.10.0PREDICTED: myb-related protein Myb4-like
RefseqXP_013746603.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A078GFQ50.0A0A078GFQ5_BRANA; BnaC03g17390D protein
TrEMBLA0A0D3B4D10.0A0A0D3B4D1_BRAOL; Uncharacterized protein
STRINGBra022831.1-P1e-179(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-131myb domain protein 14